Protein Info for HMPREF1078_RS08045 in Parabacteroides merdae CL09T00C40

Annotation: L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 66 to 82 (17 residues), see Phobius details amino acids 313 to 334 (22 residues), see Phobius details PF03313: SDH_alpha" amino acids 88 to 422 (335 residues), 214.6 bits, see alignment E=9.8e-68

Best Hits

Swiss-Prot: 84% identical to Y1130_PARD8: UPF0597 protein BDI_1130 (BDI_1130) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: None (inferred from 84% identity to pdi:BDI_1130)

Predicted SEED Role

"Putative inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (430 amino acids)

>HMPREF1078_RS08045 L-serine ammonia-lyase, iron-sulfur-dependent, subunit alpha (Parabacteroides merdae CL09T00C40)
MDKTTQTQIIKLIHQEVIPAIGCTEPVAVALAAAKAAEVLGCKPEKTEVFLSANILKNAM
GVGIPGTGMVGLPIAVALGTLIGKSAYGLEVLRDLTPEALAEGKQVIEDKRIHIALKDNV
DKLYIEVICSAGDETSRVIICHEHTNVVYVEKNGVVLTDRRKEGVSCDASGDEDELRLSF
STVYEFAMEMPLDEIRFILETADLNRKAAEASLKGNFGHTVSKTVSGVYGRKYMGDSAYT
HMLAMTAAACDARMDGAMIPVMSNSGSGNQGIAATLPVLSFAEDIECSEEQLIRALMLSH
LMVIYIKQSLGRLSALCGCVVAATGASCGITYLMGGDKVQISYAIKNMIGNITGMICDGA
KPSCAMKVSSGVSTAMLSALMAMENKVVTPVEGIIDENVDKSIINLTSIGSKGMEATDKL
VLDIMTGKSC