Protein Info for HMPREF1078_RS08035 in Parabacteroides merdae CL09T00C40

Annotation: magnesium transporter CorA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 transmembrane" amino acids 254 to 275 (22 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details PF01544: CorA" amino acids 21 to 304 (284 residues), 155.9 bits, see alignment E=7.4e-50

Best Hits

KEGG orthology group: K03284, metal ion transporter, MIT family (inferred from 82% identity to pdi:BDI_0667)

Predicted SEED Role

"Mg2+/Co2+ transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (308 amino acids)

>HMPREF1078_RS08035 magnesium transporter CorA family protein (Parabacteroides merdae CL09T00C40)
MRTFLYCEAGFVEKDQWLPNSWVNVECPTPEDIHYLTNQFNVPESFLSDIADTDERPRIE
YEGNWLLTIIRIPVQSQEQGIPFTTIPLGIMTNNEIIISVCYYKTELIPDFIRYTRRKEV
VVRHKYDLILRLIHSSAVWFLKYLKQINNEVAHAEKALEKSIRNEDLLRLMKLEKSMVYF
NTSIRGNEVMLTKLQSIFQEPVYMDNELVEDVETELKQAHLTVNIYSDILTGTMDAFASI
ISNNVNTIMKRMTSISIILMVPTLIASFYGMNVPIYGENMPHGFAIIVMISITLSALSFF
IFRKIKWF