Protein Info for HMPREF1078_RS07775 in Parabacteroides merdae CL09T00C40

Annotation: twin-arginine translocase subunit TatC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 103 to 124 (22 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details amino acids 234 to 261 (28 residues), see Phobius details TIGR00945: twin arginine-targeting protein translocase TatC" amino acids 12 to 263 (252 residues), 153.4 bits, see alignment E=4.1e-49 PF00902: TatC" amino acids 13 to 258 (246 residues), 208.4 bits, see alignment E=5.7e-66

Best Hits

KEGG orthology group: K03118, sec-independent protein translocase protein TatC (inferred from 76% identity to pdi:BDI_1758)

Predicted SEED Role

"Twin-arginine translocation protein TatC" in subsystem Cluster-based Subsystem Grouping Hypotheticals - perhaps Proteosome Related or Twin-arginine translocation system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>HMPREF1078_RS07775 twin-arginine translocase subunit TatC (Parabacteroides merdae CL09T00C40)
MAELEQEEMSFWDHLEALRWTLFRSFLALFIFAIGSFAFMRGSDGIFDRVVLAPCYSDFI
FYRWLCDLNQWLVNVSPWFDVLPDFCNDNFHVDVFNIRLASQFFTHMTTSFWLALVLTFP
YLMWEIWKFISPALYENEKKNVKWVFLLGTIMFFIGCAVGYFMVFPMTLRFLATYQLSAN
ITEQVSLDSYMDNFLMLIFVMGIVFEMPLVSWLLSKIGLLKRSFFHKYRRHAIVGLLVAA
AFITPSSDPFTLGIVFFPLYGLFELSAFFVKNDTNGDADDEDEDSTEIAPA