Protein Info for HMPREF1078_RS07755 in Parabacteroides merdae CL09T00C40

Annotation: outer membrane protein assembly factor BamD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR03302: outer membrane assembly lipoprotein YfiO" amino acids 4 to 219 (216 residues), 88.9 bits, see alignment E=1.9e-29 PF13525: YfiO" amino acids 34 to 224 (191 residues), 59.4 bits, see alignment E=2.2e-20

Best Hits

KEGG orthology group: K05807, putative lipoprotein (inferred from 92% identity to pdi:BDI_1192)

Predicted SEED Role

"lipoprotein protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>HMPREF1078_RS07755 outer membrane protein assembly factor BamD (Parabacteroides merdae CL09T00C40)
MKKVVFLLMMITVLLSSCGEYNKILKSTDYELKYSYAKKYFNAKQYSKSATLLDELVPIF
KGTANAEESLYLLAQSYYGQKDYQTASQYFNTYYTTYPKGEFTELARYYSGYGLYLDSPD
PRLDQAQTYEAINQLQLYLEYYPQSERAKEAQNIMFELQEKLAYKELLAVRLYFNLGTYM
GNNYLSCVITAQNALKNYPYSKYREEFMFYTIRAKYELAVVSVEEKLQGRYREVVDEYYN
YMNEYPEGKYVKQVQKFYDYASKRITDTY