Protein Info for HMPREF1078_RS07705 in Parabacteroides merdae CL09T00C40

Annotation: sugar transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 48 to 69 (22 residues), see Phobius details amino acids 81 to 103 (23 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 284 to 303 (20 residues), see Phobius details TIGR03025: exopolysaccharide biosynthesis polyprenyl glycosylphosphotransferase" amino acids 55 to 465 (411 residues), 404.7 bits, see alignment E=3.4e-125 PF13727: CoA_binding_3" amino acids 69 to 231 (163 residues), 33.5 bits, see alignment E=4.3e-12 PF02397: Bac_transf" amino acids 279 to 461 (183 residues), 213.3 bits, see alignment E=2e-67

Best Hits

KEGG orthology group: None (inferred from 69% identity to pdi:BDI_1744)

Predicted SEED Role

"capsular polysaccharide biosynthesis protein" in subsystem Rhamnose containing glycans

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>HMPREF1078_RS07705 sugar transferase (Parabacteroides merdae CL09T00C40)
MKKSKQAGKYILSDFISASVAWLLFNILRYEVFAIDEGADSLLDYLQYPGVLGGQVVIPL
FWLVLYYFSGYYNKPFGKSRLTELFSTFITVLIGTVFVFFALLLDDIPRSIDIYYKLFFG
MFGLQFFITYIPRLLITQSGMRKIKNREWAMKVLIIGAGGKAVRIAHDLYRLGYDICGFV
SEDERTPVKADRNQVLGTVEDIPVLMEKENVDEIVLAVESKNNKALLGILYSLYRYKRPI
KVLADRFNMLSKIQLRTIRGIPLVDVTDNNFSPAEQNIKLFLDKVCSVVALLLLSPLFAY
IAWRVKKDSPGPVFFRQERIGYLGQPFWMYKFRTMYVNAEENGPSLSSEDDLRVTPFGRI
MRKYRLDELPQFWNVLKGDMSLVGPRPERKYFIDEIVKTAPYYYLLHNVRPGITSLGMVK
YGYAASVDKMVERMEYDILYYENMSLTLDLTILIYTVKTVITGKGV