Protein Info for HMPREF1078_RS07695 in Parabacteroides merdae CL09T00C40

Annotation: methionyl-tRNA formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR00460: methionyl-tRNA formyltransferase" amino acids 6 to 318 (313 residues), 248.5 bits, see alignment E=4.3e-78 PF00551: Formyl_trans_N" amino acids 7 to 173 (167 residues), 119 bits, see alignment E=2e-38 PF02911: Formyl_trans_C" amino acids 213 to 315 (103 residues), 78.7 bits, see alignment E=3.3e-26

Best Hits

Swiss-Prot: 85% identical to FMT_PARD8: Methionyl-tRNA formyltransferase (fmt) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K00604, methionyl-tRNA formyltransferase [EC: 2.1.2.9] (inferred from 85% identity to pdi:BDI_1742)

Predicted SEED Role

"Methionyl-tRNA formyltransferase (EC 2.1.2.9)" in subsystem Conserved gene cluster associated with Met-tRNA formyltransferase or Folate Biosynthesis (EC 2.1.2.9)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>HMPREF1078_RS07695 methionyl-tRNA formyltransferase (Parabacteroides merdae CL09T00C40)
MKKEDLRIVYMGTPDFAVESLRALVEGGYNIVGVITMPDKPVGRHGSVLQASPVKQYALS
KGLPVLQPEKLKDEAFLSELRALKADLQIVVAFRMLPEVVWDMPRLGTFNLHASLLPQYR
GAAPINWAVINGDTETGATTFFLTHEIDTGKIIRQKHLPIADTDDVGIVHDGLMTMGAGL
VLETVDLLLEGKTDAVPQEEFYKDPSELRPAPKIFKETCRIDWLQPVKRVYDFIRGLSPY
PAAWTEIVSPEGVRTALKIYQAEKRPAAHELPVGTIRTDRKSYIDIAVEDGYLRLLSVQL
AGKKRLPVTDFLNGFKQIGEYKVD