Protein Info for HMPREF1078_RS07545 in Parabacteroides merdae CL09T00C40

Annotation: DUF418 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 58 to 81 (24 residues), see Phobius details amino acids 97 to 114 (18 residues), see Phobius details amino acids 120 to 136 (17 residues), see Phobius details amino acids 141 to 163 (23 residues), see Phobius details amino acids 206 to 227 (22 residues), see Phobius details amino acids 243 to 265 (23 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details amino acids 322 to 341 (20 residues), see Phobius details amino acids 351 to 371 (21 residues), see Phobius details PF04235: DUF418" amino acids 228 to 389 (162 residues), 155.7 bits, see alignment E=5.6e-50

Best Hits

KEGG orthology group: K07148, uncharacterized protein (inferred from 70% identity to pdi:BDI_0638)

Predicted SEED Role

"conserved hypothetical protein, putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (390 amino acids)

>HMPREF1078_RS07545 DUF418 domain-containing protein (Parabacteroides merdae CL09T00C40)
MEHGLLAKSPRIEVVDALRGFAVMAIMLLHNIEHFNFYDFPTASSAFMEAMDKGIWETLF
FLFSGKAYAIFSLLFGFSFFIQYNNQAKKGKDFRLRFLWRLFLLFIIGCFNGAFFPGDIL
VLYSIIGVVLVLVCRWSDRAILIAAIILMLQPLELGKFFYAMINPDYVPAAGVWRVHSQR
MYPFLSQPDFWAMVKSNLWDGQLFSLLWAWGYGRFFQTASLFLLGMLMGRRQLFANLSEH
RVFWMRTLVIGAVCFVPLYFITASLPDMISNKAMLTPMNTVVSSFRNFSFMCVLVACFVF
LWQQVSTHKMLHGLVPYGKMSLTNYLTQSIIGSFIYFGYGLSLYNVLGTTASFGVGVLLF
ILQLGFCHWWLKKFKQGPFEGAWKKATWAF