Protein Info for HMPREF1078_RS07315 in Parabacteroides merdae CL09T00C40

Annotation: DegT/DnrJ/EryC1/StrS family aminotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 388 PF01041: DegT_DnrJ_EryC1" amino acids 19 to 372 (354 residues), 365.9 bits, see alignment E=3.9e-113 PF00155: Aminotran_1_2" amino acids 42 to 278 (237 residues), 38.4 bits, see alignment E=1.3e-13

Best Hits

Swiss-Prot: 44% identical to DEGT_GEOSE: Pleiotropic regulatory protein (degT) from Geobacillus stearothermophilus

KEGG orthology group: None (inferred from 68% identity to pdi:BDI_2790)

MetaCyc: 39% identical to dTDP-3-oxo-3,4,6-trideoxy-alpha-D-glucopyranose transaminase monomer (Streptomyces venezuelae)
RXN-12768 [EC: 2.6.1.106]

Predicted SEED Role

"Pleiotropic regulatory protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.6.1.106

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (388 amino acids)

>HMPREF1078_RS07315 DegT/DnrJ/EryC1/StrS family aminotransferase (Parabacteroides merdae CL09T00C40)
MLEEQIQMVDLHGQYLRFKEEIDEAMQVVIDSCAFINGPQVKTFAGHLADYLQVPYVIPC
ANGTDALQIALMALELQPGDEVILPAFTYIAAAEVVALLGLTPVLVDVDPCTFNIDPRKI
EAAVSERTKAVVAVHLFGQACDMEPIMTLADVYHLYVVEDNAQSVGADYIFSDGRVRKAG
TIGHIGTTSFFPSKPLACYGDGGALMTSDEALATRIRMIANHGQECKYHHRRIGCNSRLD
TLQAAVLDVKLKHLEEFTETRRQVASRYDEALSSCDSLVLPARSIFSTHVYHQYTVQVKD
GRRNVLQCLLKEQGIPSMIYYPVPVHHQEAYRHISRVSGNLDVSTRLCESVLSLPIHTEM
SLGQQQYITETLKKGVCRNYPVPALDAG