Protein Info for HMPREF1078_RS07205 in Parabacteroides merdae CL09T00C40

Annotation: shikimate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13238: AAA_18
  • amino acids 4 to 113 (110 residues), 38.5 bits, E=1.6e-13
• PF01202: SKI
  • amino acids 10 to 169 (160 residues), 149.4 bits, E=1e-47

Best Hits

Swiss-Prot: 79% identical to AROK_PARD8: Shikimate kinase (aroK) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K00891, shikimate kinase [EC: 2.7.1.71] (inferred from 79% identity to pdi:BDI_2809)

Predicted SEED Role

"Shikimate kinase I (EC 2.7.1.71)" in subsystem Benzoate transport and degradation cluster or Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.7.1.71)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.71

Protein Sequence (173 amino acids)

>HMPREF1078_RS07205 shikimate kinase (Parabacteroides merdae CL09T00C40)
MKRIFLIGYMGAGKTTVGKVLSRQLGLSFIDLDHYIEGRYHKTVGQLFAEKGEDAFRDIE
RRMLREVAAFEDVLVSTGGGAPCFFDNMEFMNGAGQTVYLKVSVEELAKRLELCKSTRPI
LKGRSGDELKAFIAESLEKREPFYSKASIVFDAEEMMTDQDVYKISQELATRL