Protein Info for HMPREF1078_RS07090 in Parabacteroides merdae CL09T00C40

Annotation: phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00639: phosphoribosylglycinamide formyltransferase
  • amino acids 2 to 188 (187 residues), 155.1 bits, E=7.7e-50
• PF00551: Formyl_trans_N
  • amino acids 2 to 182 (181 residues), 155.5 bits, E=6.4e-50

Best Hits

Swiss-Prot: 37% identical to PUR3_BACSU: Phosphoribosylglycinamide formyltransferase (purN) from Bacillus subtilis (strain 168)

KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 83% identity to pdi:BDI_2826)

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (18/21 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.1.2.2

Use Curated BLAST to search for 2.1.2.2

Protein Sequence (190 amino acids)

>HMPREF1078_RS07090 phosphoribosylglycinamide formyltransferase (Parabacteroides merdae CL09T00C40)
MKNVAIFASGSGTNAENIVRYFSKSETIKVAVVLSNNRNVGVHARVNKLGVPSFVFSREE
FADGAPVLAKLAEYDTDLIVLAGFMNKISDPLLNAYPGKIINIHPALLPKYGGKGMYGIH
VHKAVIAAGERETGITIHYIDEHYDEGTVIFQAKCPVLPSDTPEEVAAKVHALEYAHYPK
VIEDLLAARI