Protein Info for HMPREF1078_RS07075 in Parabacteroides merdae CL09T00C40

Annotation: ribonuclease III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR02191: ribonuclease III" amino acids 10 to 226 (217 residues), 200 bits, see alignment E=1.8e-63 PF14622: Ribonucleas_3_3" amino acids 20 to 145 (126 residues), 107.5 bits, see alignment E=8.4e-35 PF00636: Ribonuclease_3" amino acids 45 to 131 (87 residues), 76.3 bits, see alignment E=4.5e-25 PF00035: dsrm" amino acids 161 to 226 (66 residues), 54.2 bits, see alignment E=2.7e-18

Best Hits

Swiss-Prot: 60% identical to RNC_BACTN: Ribonuclease 3 (rnc) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 76% identity to pdi:BDI_2828)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (287 amino acids)

>HMPREF1078_RS07075 ribonuclease III (Parabacteroides merdae CL09T00C40)
MNKEPYSSLYKILGFYPDNIHLYEQAFLHKSSSVESGDGRWLNNERLEFLGDAVLDAVVA
DIVYKHFQNKREGFLTNTRSKIVQRETMNRVAVELGLDKMVVYSAKLSSHNNHMYGNALE
ALIGAIYLDQGYEVCYNFIQNVLIKKHVNLETIARKEVNFKSSLIEWSQKNKLEISFDLI
ESFTDNDGNPVFQTGVTLSDTQIGVGIGYSKKESQQSAAKMAIKKLRTDKTFQQFISELK
KKKTGENTAENEFENLPEEAVENSGQEIADTEKRKAETSIEAVPAEN