Protein Info for HMPREF1078_RS07045 in Parabacteroides merdae CL09T00C40

Annotation: DUF5690 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 transmembrane" amino acids 18 to 38 (21 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 89 to 109 (21 residues), see Phobius details amino acids 115 to 136 (22 residues), see Phobius details amino acids 144 to 164 (21 residues), see Phobius details amino acids 176 to 197 (22 residues), see Phobius details amino acids 229 to 246 (18 residues), see Phobius details amino acids 266 to 288 (23 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 326 to 347 (22 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 394 to 417 (24 residues), see Phobius details PF18943: DUF5690" amino acids 41 to 420 (380 residues), 464 bits, see alignment E=1.9e-143

Best Hits

KEGG orthology group: None (inferred from 84% identity to pdi:BDI_2853)

Predicted SEED Role

"FIG00896977: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (448 amino acids)

>HMPREF1078_RS07045 DUF5690 family protein (Parabacteroides merdae CL09T00C40)
MNNEQQTKNPSRKRLSDFLFILWAGGAALLSYSLVYALRKPYTAAAFEDVEFFDMDYKVV
VTISQIVGYVISKFMGIKLISELRREERLRFILMSVVMAELSLVFFGLLSAPYNIAAMFL
NGLSLGCMWGVIFSFIEGRRMTDILASLLGVSMVISSGTAKSAGLYVMNNLHVNEFWMPA
LIGAVALPLLALLGYALNRLPQPTEEDIAMKSERATLNGKQRWELFKNFMPFLMMLFVAN
IAIVVLRDIKEDFLVNIIDVSEYSPWLFAKIDSVVTLIILVVFGLMVFVKDNLKALSILF
GLIIMGMIVMSVVSFGQERFQLPPVVWLFVQSLCLYIAYLTFQTIFFDRFIACFKIHGNV
GFFIVTTDFLGYTGTVLVLVLKEFCNPHIDWAVFYNQFAGYVGIFCCITFICSFVYLHQR
FRKENGLAVKSNEVLELDTASRNAITMA