Protein Info for HMPREF1078_RS06970 in Parabacteroides merdae CL09T00C40

Annotation: sodium-dependent transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 65 (24 residues), see Phobius details amino acids 86 to 107 (22 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 176 to 194 (19 residues), see Phobius details amino acids 215 to 237 (23 residues), see Phobius details amino acids 254 to 279 (26 residues), see Phobius details amino acids 303 to 327 (25 residues), see Phobius details amino acids 343 to 363 (21 residues), see Phobius details amino acids 381 to 400 (20 residues), see Phobius details amino acids 421 to 442 (22 residues), see Phobius details PF00209: SNF" amino acids 5 to 123 (119 residues), 91.2 bits, see alignment E=3.4e-30 amino acids 153 to 445 (293 residues), 135.9 bits, see alignment E=9.7e-44

Best Hits

Swiss-Prot: 41% identical to YHDH_BACSU: Uncharacterized sodium-dependent transporter YhdH (yhdH) from Bacillus subtilis (strain 168)

KEGG orthology group: K03308, neurotransmitter:Na+ symporter, NSS family (inferred from 86% identity to pdi:BDI_2890)

Predicted SEED Role

"Sodium-dependent transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>HMPREF1078_RS06970 sodium-dependent transporter (Parabacteroides merdae CL09T00C40)
MVDNRVTFGSKLGVILATVGCAVGLGSIWRFPYMLGTNGGAAFLLIYILFMIFLGIPVMV
TEFFIGRYSRSNTVGSFKKMAPGTKWCWIGYNGILAAFLILGFYAVVSGWTLEYVWQTVN
GNLYSTPGVDFTAGFDNFSSNALRPIFWTAVFIGLTHFVIASGVEKGIERASKIMMPLLF
FILVVMCVRSVTLPNAEAGLVYLFKPDFSKLTSSVVLSAVGQAFFSLSLGMGCLITYSSY
FGKDTNMLATAWQVTIINTFVAVLAGIMIFPAVFSFGIAPSAGAQLVFITLPNVFEQLPF
SSLWSLIFYILLAMAALTSTISLHEVVTAYIHEEFRMTRKRAAWLVSIGVFILGILSSLS
FGLLKEFTIGGLIFFDALDYLTAKIMLPLGGMLTCIFVGTRVDKKILKAELTNEGTIKFR
LFSIYVFFMKYVSPIAIGIVFLNELGLLDQLKKLF