Protein Info for HMPREF1078_RS06805 in Parabacteroides merdae CL09T00C40

Annotation: phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00877: phosphoribosylamine--glycine ligase
  • amino acids 1 to 422 (422 residues), 480.1 bits, E=2.9e-148
• PF02844: GARS_N
  • amino acids 1 to 104 (104 residues), 133 bits, E=1.2e-42
• PF01071: GARS_A
  • amino acids 105 to 298 (194 residues), 230.7 bits, E=2.7e-72
• PF02655: ATP-grasp_3
  • amino acids 140 to 293 (154 residues), 26.4 bits, E=1.4e-09
• PF02843: GARS_C
  • amino acids 333 to 421 (89 residues), 98.8 bits, E=3.7e-32

Best Hits

Swiss-Prot: 49% identical to PUR2_VIBCH: Phosphoribosylamine--glycine ligase (purD) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 89% identity to pdi:BDI_3095)

MetaCyc: 50% identical to phosphoribosylamine--glycine ligase (Escherichia coli K-12 substr. MG1655)
Phosphoribosylamine--glycine ligase. [EC: 6.3.4.13]

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (38/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (18/21 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (20/26 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Protein Sequence (423 amino acids)

>HMPREF1078_RS06805 phosphoribosylamine--glycine ligase (Parabacteroides merdae CL09T00C40)
MNILLLGSGGREHAIAWKIAQSPKVDQLFIAPGNAGTALVGTNVNIKADDFSAIKEFALA
NHIGMVVVGPEDPLVKGVYDYFKNDVALAGIPVIGPSKEGAQLEGSKDFAKAFMMRHNIP
TARYKSISAGNLEEGYAFLEELQAPYVLKADGLAAGKGVLILDTLEEAKKELDDMLGGMF
GDASKTVVIEEFLDGIECSVFVMTDGESYKVLPVAKDYKRIGEGNTGLNTGGMGAVSPVP
FADETFMQKVDERIIRPTIEGLKAENIDYKGFIFLGLINVKGEPMVIEYNCRMGDPETEV
VMLRIQSDLVELLEGVAEGNLGSRTLVHDPRAAVTVMLVSGGYPEAYEKGKVISGLDKVP
AENIIFHAGTKAADGQILTSGGRVIAVSSYGADKEEALARSFAGAKLIDFEKKYFRNDIG
FDL