Protein Info for HMPREF1078_RS06565 in Parabacteroides merdae CL09T00C40

Annotation: non-canonical purine NTP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00042: non-canonical purine NTP pyrophosphatase, RdgB/HAM1 family
  • amino acids 2 to 188 (187 residues), 186.7 bits, E=1.4e-59
• PF01725: Ham1p_like
  • amino acids 3 to 186 (184 residues), 234.8 bits, E=3.5e-74

Best Hits

Swiss-Prot: 82% identical to IXTPA_PARD8: dITP/XTP pyrophosphatase (BDI_3010) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01516, nucleoside-triphosphatase [EC: 3.6.1.15] (inferred from 82% identity to pdi:BDI_3010)

Predicted SEED Role

"Nucleoside 5-triphosphatase RdgB (dHAPTP, dITP, XTP-specific) (EC 3.6.1.15)" in subsystem Heat shock dnaK gene cluster extended (EC 3.6.1.15)

MetaCyc Pathways

• UTP and CTP dephosphorylation I (5/7 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (12/18 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (5/9 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (4/8 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (3/7 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (4/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (7/14 steps found)

KEGG Metabolic Maps

• Purine metabolism
• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.15

Protein Sequence (193 amino acids)

>HMPREF1078_RS06565 non-canonical purine NTP diphosphatase (Parabacteroides merdae CL09T00C40)
MKLVFATNNRHKLDEVRKITSGYTEIVSLSEINCHEDIPETAETLEGNALQKARYIKEHF
GYDCFADDTGLEVEALHNAPGVYSARYAGPGHDSEANMDKLLHEMENKKNRKARFRTVIA
LILNGKEYLFEGIVNGTIINEKRGESGFGYDPIFVPDTYSQTFAEMGNDIKNQISHRAEA
VKKLTAFLSNYTF