Protein Info for HMPREF1078_RS06060 in Parabacteroides merdae CL09T00C40

Annotation: mandelate racemase/muconate lactonizing enzyme family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF02746: MR_MLE_N" amino acids 18 to 111 (94 residues), 61 bits, see alignment E=1.3e-20 PF13378: MR_MLE_C" amino acids 136 to 371 (236 residues), 187.1 bits, see alignment E=3.9e-59

Best Hits

Predicted SEED Role

"Gluconate dehydratase (EC 4.2.1.39)" in subsystem Entner-Doudoroff Pathway (EC 4.2.1.39)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.39

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>HMPREF1078_RS06060 mandelate racemase/muconate lactonizing enzyme family protein (Parabacteroides merdae CL09T00C40)
MKITDVKVWLVQGIKYNWTLLKIYTDEGYTGVGEATNWPGSPIVFEAAKHVGQRIIGLDP
MKTDFIWTKLYRDLNWIGPYGASLCAISGIDMALLDLKAKVLGVPCYELLGGAYRKDIQL
YANYWFTGGGHNEADYAAQARRVMDAGFTGLKFDPFAHTNYFYGEDLASNLTLTAEQQDL
AFNVSKAVREAVGSECDIMIETHAMLNYRVAVKMAERLAKLDITWYEEPAGPESSQTLRA
MRERIPSDVAICVGERHYTRFGIRSLLEKHVCDVIMPDITRCGGPSEMKRMATMAEAYNV
LIAPHNPNGPLSTLASSHVCAAIPNFFRQEFMFNDVPWRDTVIDHPIAEMVYDGHLHLSD
RPGLGVDLVEEEMEKHPGITTDAPDNFYI