Protein Info for HMPREF1078_RS05930 in Parabacteroides merdae CL09T00C40

Annotation: glycine cleavage system protein GcvH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00527: glycine cleavage system H protein
  • amino acids 3 to 125 (123 residues), 157.2 bits, E=1.1e-50
• PF01597: GCV_H
  • amino acids 7 to 125 (119 residues), 149 bits, E=3.1e-48

Best Hits

Swiss-Prot: 85% identical to GCSH_PARD8: Glycine cleavage system H protein (gcvH) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K02437, glycine cleavage system H protein (inferred from 85% identity to pdi:BDI_3171)

MetaCyc: 48% identical to glycine cleavage system H protein (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Glycine cleavage system H protein" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)

Protein Sequence (126 amino acids)

>HMPREF1078_RS05930 glycine cleavage system protein GcvH (Parabacteroides merdae CL09T00C40)
MNFPADLKYTKDHEWIRVDGDVAYVGITDYAQGELGEIVFVDITTEGEVVAKEEVFGTIE
AVKTVSDLFMPVSGEVIEANAELDDKPELVNEDVYGNGWLIKISVSDPSELDELMSAAEY
EQMIAK