Protein Info for HMPREF1078_RS05835 in Parabacteroides merdae CL09T00C40

Annotation: M20 family metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04389: Peptidase_M28
  • amino acids 59 to 132 (74 residues), 24.1 bits, E=4e-09
• PF01546: Peptidase_M20
  • amino acids 62 to 345 (284 residues), 72.8 bits, E=5.6e-24
• PF07687: M20_dimer
  • amino acids 163 to 261 (99 residues), 62.4 bits, E=5.4e-21

Best Hits

KEGG orthology group: K01438, acetylornithine deacetylase [EC: 3.5.1.16] (inferred from 85% identity to pdi:BDI_3099)

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (9/9 steps found)
• L-arginine biosynthesis I (via L-ornithine) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of arginine and polyamine biosynthesis (10/17 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.16

Protein Sequence (351 amino acids)

>HMPREF1078_RS05835 M20 family metallo-hydrolase (Parabacteroides merdae CL09T00C40)
MYYDAIDLLKGMISRPSFSREEGETADFLKQSWEKAGYKVNRKGNNLWLIAPGFDLDKPT
LLLNSHIDTVKPASGWTKDPFNPEETEDERLYGLGSNDAGASVVSLYEAFRVLSGKEQPY
NLIFLASCEEEVSGKNGLESALADLPPIAFAVVGEPTGMQPAVAEKGLMVLDCVSTGKAG
HAARNEGINAITLAMKDIEWFNTYQFPEKSDFLGPVKMSVTIIHAGTQHNVVPDRCEFTV
DIRTNEFYPNEKLFELIKSQVGCEIKARSFRLNSTRTDLQHPFVRRAVMMGKEPFGSPTL
SDQALMHFPSVKIGPGNSARSHAADEYIGLMEIREAIDMYIKLLDQLTIDN