Protein Info for HMPREF1078_RS05635 in Parabacteroides merdae CL09T00C40

Annotation: 3-phosphoshikimate 1-carboxyvinyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00275: EPSP_synthase
  • amino acids 6 to 57 (52 residues), 34.3 bits, 5.9e-13
  • amino acids 63 to 398 (336 residues), 240.8 bits, E=1.2e-75

Best Hits

Swiss-Prot: 65% identical to AROA_BACFR: 3-phosphoshikimate 1-carboxyvinyltransferase (aroA) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K00800, 3-phosphoshikimate 1-carboxyvinyltransferase [EC: 2.5.1.19] (inferred from 84% identity to pdi:BDI_3146)

Predicted SEED Role

"5-Enolpyruvylshikimate-3-phosphate synthase (EC 2.5.1.19)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 2.5.1.19)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (37/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.19

Protein Sequence (410 amino acids)

>HMPREF1078_RS05635 3-phosphoshikimate 1-carboxyvinyltransferase (Parabacteroides merdae CL09T00C40)
MNYTIKSPDSLKASVKLPASKSICNRALILNALSYSPYEIRNLSDCDDTEVMVKALNSND
RDFDIKAAGTAMRFLTAFLSKVVGEWTITGTERMKNRPIKILVDALNALGARVEYMEKEG
YPPLRIFGSALQGGEISLAGGVSSQYISALLMIAPLMENGLTLHLEGVVISKPYINLTLQ
LMEQYGVKAEWNGQTIKVRPQDYHPIPFTVESDWSAASYWYSMMALSKNAEIELLGLFKN
SLQGDAAGAKLFAQLGVGTTYTDRGVVLKHNGNRTKKLNYNFVNEPDLAQTFVVTCVLLN
IPFRFTGLQSLKIKETDRIEALKTELRKLGYLLTDSNNSILEWNGERCEPQAHPVITTYE
DHRMAMAFAPAALVLPEGIEIADPQVVSKSYPHYWRDLRTAGFIIIDNEQ