Protein Info for HMPREF1078_RS05625 in Parabacteroides merdae CL09T00C40
Annotation: metal ABC transporter permease
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 39% identical to Y2045_SYNY3: Uncharacterized membrane protein slr2045 (slr2045) from Synechocystis sp. (strain PCC 6803 / Kazusa)
KEGG orthology group: K09816, zinc transport system permease protein (inferred from 88% identity to pdi:BDI_3148)Predicted SEED Role
"Zinc ABC transporter, inner membrane permease protein ZnuB" in subsystem Transport of Zinc
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (267 amino acids)
>HMPREF1078_RS05625 metal ABC transporter permease (Parabacteroides merdae CL09T00C40) MDLLQYGFFQHALLGSLLTAIACGIVGTYIVSRRLVFISGGITHASFGGLGLGFYLGMNP ILMAMLFSVLSAFGVEWASKTQNVREDSAIAGIWSLGMALGVIFIFLTPGYAPNLSAYLF GNILTVSTGDIIWIAALALLLVILFSLFLREIVYVAFDRDFALTQGVPVKCIEYVMMCCI AVTIVLSIRLVGIMLLMSLLTLPQITVNLFTSDFKKIIFGSIAIGFLGCVFGLVLSYLLN VPSGAFIILVLVLFFLIVKAIKAVLKR