Protein Info for HMPREF1078_RS05545 in Parabacteroides merdae CL09T00C40

Annotation: 4-hydroxy-tetrahydrodipicolinate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01113: DapB_N
  • amino acids 1 to 103 (103 residues), 54.4 bits, E=1.4e-18
• TIGR00036: 4-hydroxy-tetrahydrodipicolinate reductase
  • amino acids 44 to 236 (193 residues), 149 bits, E=1e-47
• PF05173: DapB_C
  • amino acids 106 to 236 (131 residues), 138.5 bits, E=1.4e-44

Best Hits

Swiss-Prot: 36% identical to DAPB_CHLPM: 4-hydroxy-tetrahydrodipicolinate reductase (dapB) from Chlorobium phaeovibrioides (strain DSM 265 / 1930)

KEGG orthology group: K00215, dihydrodipicolinate reductase [EC: 1.3.1.26] (inferred from 86% identity to pdi:BDI_2847)

Predicted SEED Role

"4-hydroxy-tetrahydrodipicolinate reductase (EC 1.17.1.8)" (EC 1.17.1.8)

MetaCyc Pathways

• L-lysine biosynthesis III (7/7 steps found)
• L-lysine biosynthesis VI (7/7 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (12/15 steps found)
• aspartate superpathway (19/25 steps found)
• L-lysine biosynthesis II (7/9 steps found)
• L-lysine biosynthesis I (6/9 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (12/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.17.1.8 or 1.3.1.26

Protein Sequence (238 amino acids)

>HMPREF1078_RS05545 4-hydroxy-tetrahydrodipicolinate reductase (Parabacteroides merdae CL09T00C40)
MKIALIGYGKMGKTIEQIALGRGHQIVSIVDINNPEEIHSDKFKSADVAIEFTTPATAFN
NYMQCFAAGIPVVSGTTGWLDKIGQVKDMCEKEGKTFFYASNFSIGVNIFFAINKYLAKI
MNNFSAYDIKMMETHHIHKLDAPSGTAITLAEGIIENVDRKDRWTLETAEKTTDIPIHAI
RKGEVPGIHEITYESDVDTISIKHDAKSRAGFALGAVIAAEFTAGKKGFLGMDDMLKF