Protein Info for HMPREF1078_RS05355 in Parabacteroides merdae CL09T00C40

Annotation: tetratricopeptide repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 271 to 289 (19 residues), see Phobius details PF14559: TPR_19" amino acids 146 to 208 (63 residues), 28 bits, see alignment E=2.3e-10

Best Hits

Predicted SEED Role

"TPR-repeat-containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (411 amino acids)

>HMPREF1078_RS05355 tetratricopeptide repeat protein (Parabacteroides merdae CL09T00C40)
MIHNVKILFFICFFTACSSTEQKEIVTAGELLRQAAFYGERLQFLPALETYQQAIKLAEK
EKDSTVFSLAYLEMGKIYRYQSLKQKALQSEKKALSYIKSPACDSLRLELYREIGDMYTL
SGQADSAFHYYEMAGCRIKQAKILQQNGSNKEAETLLKTELEQTIFPKEKAEVCLALADL
QITLGKLDEAEKSLSQVPPSHPHLYAALSRIAQSRGDSLQADFYHKSYLHHLSVLRQEKE
QNQITQLLRTSEQKEWEKRLTDSQKAQKEQIYVWVTLLVSCSTGIWGYSRYRQKRNVVSL
SETDFFSSEIYLRFHRKEEWKPVPKDWEELLQAFNRTYPDFRERLKRKIPKLSEQEWRMC
CLIKMEVPPSTAAMLLCCTNQAISMRRVRLYQKITGEKGTPELCDSFIRDF