Protein Info for HMPREF1078_RS04925 in Parabacteroides merdae CL09T00C40

Annotation: elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR00038: translation elongation factor P" amino acids 2 to 186 (185 residues), 212.3 bits, see alignment E=2.2e-67 PF08207: EFP_N" amino acids 4 to 60 (57 residues), 75.4 bits, see alignment E=4.3e-25 PF01132: EFP" amino acids 68 to 114 (47 residues), 52.4 bits, see alignment E=6.4e-18 PF09285: Elong-fact-P_C" amino acids 130 to 185 (56 residues), 94 bits, see alignment E=5.4e-31

Best Hits

Swiss-Prot: 94% identical to EFP_PARD8: Elongation factor P (efp) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K02356, elongation factor P (inferred from 94% identity to pdi:BDI_2588)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>HMPREF1078_RS04925 elongation factor P (Parabacteroides merdae CL09T00C40)
MINSQDIKKGTCIRLDGKLYFCVDFLHVKPGKGNTIMRTTLKDVVKGGQIERRFNIGEKL
EDVRVERRPYQYTYQEGEHYHFMNQETFDDIIIDKNLINGVDFMIEGQIVEVVSDASTET
VLFADMPVKVQLKVTYTEPGIKGDTATNTLKPATVESGAEVRVPLFIEEGEIIEINTQDG
SYVGRIR