Protein Info for HMPREF1078_RS04920 in Parabacteroides merdae CL09T00C40

Annotation: LrgB family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 transmembrane" amino acids 6 to 26 (21 residues), see Phobius details amino acids 33 to 51 (19 residues), see Phobius details amino acids 63 to 81 (19 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 148 to 169 (22 residues), see Phobius details amino acids 181 to 201 (21 residues), see Phobius details amino acids 207 to 230 (24 residues), see Phobius details PF04172: LrgB" amino acids 16 to 226 (211 residues), 250.4 bits, see alignment E=6.3e-79

Best Hits

Swiss-Prot: 40% identical to YOHK_ECOLI: Inner membrane protein YohK (yohK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 84% identity to pdi:BDI_2587)

Predicted SEED Role

"LrgA-associated membrane protein LrgB" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (232 amino acids)

>HMPREF1078_RS04920 LrgB family protein (Parabacteroides merdae CL09T00C40)
MNNLAQSEVFSLTLVIGTYLASLALYRKTRISLLHPLITSIFVIIVVLKTMDIEYESFQK
GSHLIHFLLGPSVVALGYVLYEQIQYLKGNVISILTSVFVGAIVGIVSVIAIGELMGADA
ALVATLEPKSVTTPIAMGIAEKSGGIPSLTAVIVVAVGIFGSIVGPFVMKVLGIESRIAK
GLALGASSHGVGTSVAIQIGAVEGALSGLAIGLMGIMTAILVPVISFIISLF