Protein Info for HMPREF1078_RS04830 in Parabacteroides merdae CL09T00C40

Annotation: HAD-IB family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 transmembrane" amino acids 35 to 50 (16 residues), see Phobius details TIGR01490: HAD hydrolase, family IB" amino acids 3 to 193 (191 residues), 116.5 bits, see alignment E=1.9e-37 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 4 to 185 (182 residues), 74 bits, see alignment E=1.5e-24 PF12710: HAD" amino acids 4 to 183 (180 residues), 111.3 bits, see alignment E=4e-36

Best Hits

Predicted SEED Role

"Phosphoserine phosphatase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (197 amino acids)

>HMPREF1078_RS04830 HAD-IB family hydrolase (Parabacteroides merdae CL09T00C40)
MAIAIFDFDGTIISRDSLPDFLIQACGRKAFLLRLPWIILLKGAALTGILSTHRAKELVI
TSFLRGMKTEDFQQACLEYASRIPAFVYPAALEEIRRHQEEGNKIAIISASVPDWIRPWA
QTVGIRFVEGTGLEVREQTLTGRFSTPNCKGGEKVRRLRRLYPDFASETLHVYGDSSGDK
ELLTLADVPHYKPFNNK