Protein Info for HMPREF1078_RS04825 in Parabacteroides merdae CL09T00C40

Annotation: decaprenyl-phosphate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 transmembrane" amino acids 12 to 36 (25 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 89 to 112 (24 residues), see Phobius details amino acids 118 to 136 (19 residues), see Phobius details amino acids 143 to 161 (19 residues), see Phobius details amino acids 167 to 185 (19 residues), see Phobius details amino acids 211 to 231 (21 residues), see Phobius details amino acids 244 to 260 (17 residues), see Phobius details amino acids 281 to 297 (17 residues), see Phobius details PF01040: UbiA" amino acids 31 to 262 (232 residues), 79.6 bits, see alignment E=1.2e-26

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>HMPREF1078_RS04825 decaprenyl-phosphate phosphoribosyltransferase (Parabacteroides merdae CL09T00C40)
MKDIQSTGKVKALFLLMRPSQWVKNIILFLPMFFAQEIGDPDRLWNVAILFAGFCLLTSG
VYVFNDLMDAGEDRLHQVKRFRPIASRKVSPMAALVFMFLLYGTSALCFSFMHTSNNQIW
LLSGGYILLNLAYTLYLKQIQIIDAMIVACGFIIRLEAGAVAGEIELSHWLIIMTFILSL
FLAFAKRRDDLRNFMETGQISRKNITGYTIDYLNVILSFLSSIIAVTYILYTLSPEVTSR
SSEYLYATVPFVLAGIMRYLQIILVEKSNCNPTDILLQDRTLQLTVAGWFIVFALLIY