Protein Info for HMPREF1078_RS04800 in Parabacteroides merdae CL09T00C40

Annotation: phosphatidylserine decarboxylase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00164: phosphatidylserine decarboxylase homolog
  • amino acids 34 to 218 (185 residues), 163.9 bits, E=1.6e-52
• PF02666: PS_Dcarbxylase
  • amino acids 47 to 215 (169 residues), 141.2 bits, E=1.8e-45

Best Hits

Swiss-Prot: 90% identical to PSD_PARD8: Phosphatidylserine decarboxylase proenzyme (psd) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K01613, phosphatidylserine decarboxylase [EC: 4.1.1.65] (inferred from 90% identity to pdi:BDI_2570)

Predicted SEED Role

"Phosphatidylserine decarboxylase (EC 4.1.1.65)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 4.1.1.65)

MetaCyc Pathways

• phosphatidylserine and phosphatidylethanolamine biosynthesis I (2/2 steps found)
• cardiolipin and phosphatidylethanolamine biosynthesis (Xanthomonas) (3/4 steps found)
• superpathway of phospholipid biosynthesis III (E. coli) (8/12 steps found)
• superpathway of cardiolipin biosynthesis (bacteria) (8/13 steps found)
• superpathway of phospholipid biosynthesis II (plants) (9/28 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.65

Protein Sequence (220 amino acids)

>HMPREF1078_RS04800 phosphatidylserine decarboxylase family protein (Parabacteroides merdae CL09T00C40)
MKVHKEGTGLLLTLFTIFFVVDVALYHTVGRGWVFYTTTFVTTVLFLLVLNFFRSPFRRF
PFDSEGLVIAPADGTIVAIEEVMENEILHRECLQISIFMSVFNVHANWFPVNGTVKHVSH
QNGRFRAAYLPKSSTENERSAVVITTRNGVDVLARQIAGALARRIVTYAKVGDKCHVDEQ
MGFIKFGSRVDVYLPVGTEVLVEMDQKVTGNQTPIARLGK