Protein Info for HMPREF1078_RS04745 in Parabacteroides merdae CL09T00C40

Annotation: FecR domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 313 transmembrane" amino acids 68 to 90 (23 residues), see Phobius details PF04773: FecR" amino acids 103 to 198 (96 residues), 69.3 bits, see alignment E=3.3e-23 PF16344: FecR_C" amino acids 242 to 310 (69 residues), 54.3 bits, see alignment E=1.1e-18

Best Hits

KEGG orthology group: None (inferred from 46% identity to bvu:BVU_1805)

Predicted SEED Role

"putative anti-sigma factor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (313 amino acids)

>HMPREF1078_RS04745 FecR domain-containing protein (Parabacteroides merdae CL09T00C40)
MEKETLYKFFDGKASREEKEAVRIWLESSPENEQELFKEREFFDAMILSGSTKVAGMEKK
SRPFYRTVLLEAIKIAAVFAITVASGTYFYKSEICKIGEAMNTITVPAGQRANLTLADGT
NVWLNARSEMRYPAVFTGNKREITLDGEAYFEVTHNEDKPFVVQTNKCNVEVLGTKFNVE
AYSDSEDFCTSLMEGSVRVSDKRNPSETLVLAPNQQVSLINGHLQSKSIADFDPFRWKEG
LICFKDMNLKELMSRFEKCYGIHVIIENPKLTDYICSGKFRISDGIDKALHILQKDAKYT
FERNKDESVIYIK