Protein Info for HMPREF1078_RS04705 in Parabacteroides merdae CL09T00C40

Annotation: site-specific tyrosine recombinase XerD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 PF02899: Phage_int_SAM_1" amino acids 8 to 86 (79 residues), 66 bits, see alignment E=4.4e-22 PF13495: Phage_int_SAM_4" amino acids 9 to 87 (79 residues), 27.6 bits, see alignment E=4.7e-10 TIGR02225: tyrosine recombinase XerD" amino acids 10 to 296 (287 residues), 353.5 bits, see alignment E=4.4e-110 PF00589: Phage_integrase" amino acids 112 to 283 (172 residues), 160 bits, see alignment E=7.8e-51

Best Hits

Swiss-Prot: 42% identical to XERD_STAHJ: Tyrosine recombinase XerD (xerD) from Staphylococcus haemolyticus (strain JCSC1435)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 86% identity to pdi:BDI_3300)

Predicted SEED Role

"Phage integrase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (301 amino acids)

>HMPREF1078_RS04705 site-specific tyrosine recombinase XerD (Parabacteroides merdae CL09T00C40)
MHRENDKIERYKTYLRLEKALSANSIDAYLTDLDKLTNFVESEGKKYADVTYDDLQQFVA
RLHDIGIHPRSQARIISGIKSFYRFLFLDDYITTDPTELLESPKIGLKLPEVLTVNEINS
ILDTIDLTLPEGQRNRAMLEVLYSCGLRVSELVSLRFTDVYFDEGFIKVEGKGSKQRLVP
ISETAIKEIKNYLYDRNHVAVKKGFEDILFLSRRGTALSRIMVFHIIKQQTEMAGIKKNV
SPHTFRHSFATHLLEGGANLLAIQEMLGHEKITTTEIYTHIDRQFLRKEILEHHPRSKPR
D