Protein Info for HMPREF1078_RS04580 in Parabacteroides merdae CL09T00C40

Annotation: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 PF01676: Metalloenzyme" amino acids 3 to 492 (490 residues), 266.4 bits, see alignment E=4.1e-83 TIGR01307: phosphoglycerate mutase (2,3-diphosphoglycerate-independent)" amino acids 3 to 503 (501 residues), 674.7 bits, see alignment E=3.6e-207 PF06415: iPGM_N" amino acids 81 to 291 (211 residues), 263.9 bits, see alignment E=1.5e-82 PF01663: Phosphodiest" amino acids 362 to 443 (82 residues), 31.9 bits, see alignment E=1.6e-11

Best Hits

Swiss-Prot: 96% identical to GPMI_BACV8: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (gpmI) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 96% identity to bvu:BVU_1375)

Predicted SEED Role

"2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (505 amino acids)

>HMPREF1078_RS04580 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Parabacteroides merdae CL09T00C40)
MSKKALLMILDGWGIGDQGKDDVIFNTPTPYWDSLLATYPHSQLQASGENVGLPDGQMGN
SEVGHLNIGAGRIVYQDLVKINRACADNSIMKNPEIVSAFSYAKEHGKNIHFMGLTSNGG
VHSSFDHLFKLCDISKEYGIDNTFIHCFMDGRDTDPKSGKGFIEQLTAHCAQSAGKIASI
VGRFYAMDRDKRWERVKEAYDLLVEGKGKQATDMVQAMQESYDEGVTDEFIKPINNATVD
GTIKEGDVVIFFNYRNDRAKELTVVLTQQDMPEQGMHTIPGLQYYCMTPYDASFKGVHIL
FDKENVQNTLGEYLAENGKTQLHIAETEKYAHVTFFFNGGRETPYKNEERILVPSPKVAT
YDLKPEMSAYEVKDKLVEAINTQKFDFIVVNYANGDMVGHTGIYSAIEKAVTAIDNCVKD
TVEAAKANGYEVIIIADHGNADHALNEDGTPNTAHSLNPVPFVYVTENKNAKVENGVLAD
VAPSILHILGMAQPADMTGQDLIKN