Protein Info for HMPREF1078_RS04580 in Parabacteroides merdae CL09T00C40

Annotation: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01307: phosphoglycerate mutase (2,3-diphosphoglycerate-independent)
  • amino acids 3 to 503 (501 residues), 674.7 bits, E=3.6e-207
• PF01676: Metalloenzyme
  • amino acids 3 to 492 (490 residues), 266.4 bits, E=4.1e-83
• PF06415: iPGM_N
  • amino acids 81 to 291 (211 residues), 263.9 bits, E=1.5e-82
• PF01663: Phosphodiest
  • amino acids 362 to 443 (82 residues), 31.9 bits, E=1.6e-11

Best Hits

Swiss-Prot: 96% identical to GPMI_BACV8: 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (gpmI) from Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / NBRC 14291 / NCTC 11154)

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 96% identity to bvu:BVU_1375)

Predicted SEED Role

"2,3-bisphosphoglycerate-independent phosphoglycerate mutase (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)

MetaCyc Pathways

• superpathway of glucose and xylose degradation (16/17 steps found)
• glycolysis III (from glucose) (11/11 steps found)
• homolactic fermentation (11/12 steps found)
• glycolysis II (from fructose 6-phosphate) (10/11 steps found)
• glycolysis IV (9/10 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• gluconeogenesis I (11/13 steps found)
• glycolysis I (from glucose 6-phosphate) (11/13 steps found)
• Bifidobacterium shunt (12/15 steps found)
• Rubisco shunt (8/10 steps found)
• Entner-Doudoroff pathway III (semi-phosphorylative) (7/9 steps found)
• superpathway of N-acetylneuraminate degradation (16/22 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (16/22 steps found)
• glycolysis VI (from fructose) (8/11 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (13/19 steps found)
• superpathway of anaerobic sucrose degradation (13/19 steps found)
• superpathway of hexitol degradation (bacteria) (12/18 steps found)
• glycolysis V (Pyrococcus) (6/10 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (17/26 steps found)
• ethene biosynthesis V (engineered) (16/25 steps found)
• photorespiration II (5/10 steps found)
• glycerol degradation to butanol (8/16 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (13/26 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (13/27 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (19/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Protein Sequence (505 amino acids)

>HMPREF1078_RS04580 2,3-bisphosphoglycerate-independent phosphoglycerate mutase (Parabacteroides merdae CL09T00C40)
MSKKALLMILDGWGIGDQGKDDVIFNTPTPYWDSLLATYPHSQLQASGENVGLPDGQMGN
SEVGHLNIGAGRIVYQDLVKINRACADNSIMKNPEIVSAFSYAKEHGKNIHFMGLTSNGG
VHSSFDHLFKLCDISKEYGIDNTFIHCFMDGRDTDPKSGKGFIEQLTAHCAQSAGKIASI
VGRFYAMDRDKRWERVKEAYDLLVEGKGKQATDMVQAMQESYDEGVTDEFIKPINNATVD
GTIKEGDVVIFFNYRNDRAKELTVVLTQQDMPEQGMHTIPGLQYYCMTPYDASFKGVHIL
FDKENVQNTLGEYLAENGKTQLHIAETEKYAHVTFFFNGGRETPYKNEERILVPSPKVAT
YDLKPEMSAYEVKDKLVEAINTQKFDFIVVNYANGDMVGHTGIYSAIEKAVTAIDNCVKD
TVEAAKANGYEVIIIADHGNADHALNEDGTPNTAHSLNPVPFVYVTENKNAKVENGVLAD
VAPSILHILGMAQPADMTGQDLIKN