Protein Info for HMPREF1078_RS04555 in Parabacteroides merdae CL09T00C40

Annotation: HAMP domain-containing sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 256 to 279 (24 residues), see Phobius details PF00512: HisKA" amino acids 287 to 351 (65 residues), 51.6 bits, see alignment E=8.2e-18 PF02518: HATPase_c" amino acids 402 to 514 (113 residues), 82.3 bits, see alignment E=3.5e-27

Best Hits

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 82% identity to pdi:BDI_2479)

Predicted SEED Role

"Two-component system sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>HMPREF1078_RS04555 HAMP domain-containing sensor histidine kinase (Parabacteroides merdae CL09T00C40)
MRKSTIWLLAVVMAFAFAGLLFLQVKYVSIILKKSSEQFNETVKRSMHQVSKNLELDETA
RYLEEDLSRDEANNYLYQNEQSSLGGGIITEKKYKMQFTNADGTVEHIEFHSDIRTRKFE
PLSSLGSNKVPNSIVSTSKDLQQTLKRRYQYQSGLFNEVILNILHTANLKPIEERIDFKK
LNNYLKSEFVNNGLNLPFVFAVINKDGKIVYQNGDIPPVSDVIQQVLFPNDPPSKQNYLK
VYFPTKGDYISSSVTFIVPSIIFSLILLVTFIFTIYIVFRQKRLSEMKNDFINNMTHELK
TPVSTISLAAQMLKDSDITKSPDVFKHISGVINDETKRLGFLVEKVLQMSLFERQKAALK
LKEVDANDLLASVANTFALKVEKYDGTIDIDLQAEDSDIYVDEMHITNVLFNLLDNAVKY
RRLEVPLTLMCRTWNENGKLLISIEDNGIGIKKEYLKKVFDRFFRVPTGNVHDVKGFGLG
LAYVRKIVEDHKGTIRAEVGTGNVGTKFIITLPLIKS