Protein Info for HMPREF1078_RS04545 in Parabacteroides merdae CL09T00C40

Annotation: 5'/3'-nucleotidase SurE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 258 PF01975: SurE" amino acids 8 to 191 (184 residues), 187.3 bits, see alignment E=1.3e-59 TIGR00087: 5'/3'-nucleotidase SurE" amino acids 8 to 242 (235 residues), 170 bits, see alignment E=3.1e-54

Best Hits

Swiss-Prot: 85% identical to SURE_PARD8: 5'-nucleotidase SurE (surE) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 85% identity to pdi:BDI_2635)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (258 amino acids)

>HMPREF1078_RS04545 5'/3'-nucleotidase SurE (Parabacteroides merdae CL09T00C40)
MMNDRPLILITNDDGVEAKGIKELTECLRDLGDIVVFAPDGPRSGMASAITSLVPIKYTL
VRKEKGLTVYSCTGTPVDCVKLAINEVLERKPDLLASGINHGGNHAICIQYSGTMGAAAE
GCVFGIPSMGVSLLDHRADADFAESCRLGRMLARRIIKEGLPHGTYLNLNVPNVPNVKGM
KVCRQADGRWTNEFKRSENAAGEPVFWLAGAFENAKPIHADNDTLALDSGYASLVPCKID
VTDYDFLAVLKNQLKVES