Protein Info for HMPREF1078_RS04545 in Parabacteroides merdae CL09T00C40

Annotation: 5'/3'-nucleotidase SurE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01975: SurE
  • amino acids 8 to 191 (184 residues), 187.3 bits, E=1.3e-59
• TIGR00087: 5'/3'-nucleotidase SurE
  • amino acids 8 to 242 (235 residues), 170 bits, E=3.1e-54

Best Hits

Swiss-Prot: 85% identical to SURE_PARD8: 5'-nucleotidase SurE (surE) from Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152)

KEGG orthology group: K03787, 5'-nucleotidase [EC: 3.1.3.5] (inferred from 85% identity to pdi:BDI_2635)

Predicted SEED Role

"5-nucleotidase SurE (EC 3.1.3.5)" in subsystem Folate Biosynthesis (EC 3.1.3.5)

MetaCyc Pathways

• guanosine nucleotides degradation II (3/4 steps found)
• guanosine nucleotides degradation III (3/4 steps found)
• inosine 5'-phosphate degradation (3/4 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• NAD salvage pathway III (to nicotinamide riboside) (2/3 steps found)
• superpathway of guanosine nucleotides degradation (plants) (4/6 steps found)
• purine nucleotides degradation I (plants) (8/12 steps found)
• adenosine nucleotides degradation I (5/8 steps found)
• guanosine nucleotides degradation I (2/4 steps found)
• adenosine nucleotides degradation II (2/5 steps found)
• ureide biosynthesis (3/7 steps found)
• NAD salvage (plants) (4/11 steps found)
• tunicamycin biosynthesis (2/9 steps found)
• superpathway of purines degradation in plants (8/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Nicotinate and nicotinamide metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.5

Use Curated BLAST to search for 3.1.3.5

Protein Sequence (258 amino acids)

>HMPREF1078_RS04545 5'/3'-nucleotidase SurE (Parabacteroides merdae CL09T00C40)
MMNDRPLILITNDDGVEAKGIKELTECLRDLGDIVVFAPDGPRSGMASAITSLVPIKYTL
VRKEKGLTVYSCTGTPVDCVKLAINEVLERKPDLLASGINHGGNHAICIQYSGTMGAAAE
GCVFGIPSMGVSLLDHRADADFAESCRLGRMLARRIIKEGLPHGTYLNLNVPNVPNVKGM
KVCRQADGRWTNEFKRSENAAGEPVFWLAGAFENAKPIHADNDTLALDSGYASLVPCKID
VTDYDFLAVLKNQLKVES