Protein Info for HMPREF1078_RS04500 in Parabacteroides merdae CL09T00C40

Annotation: cytochrome ubiquinol oxidase subunit I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 transmembrane" amino acids 22 to 44 (23 residues), see Phobius details amino acids 59 to 78 (20 residues), see Phobius details amino acids 98 to 123 (26 residues), see Phobius details amino acids 134 to 156 (23 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details amino acids 225 to 243 (19 residues), see Phobius details amino acids 400 to 422 (23 residues), see Phobius details amino acids 434 to 455 (22 residues), see Phobius details amino acids 486 to 506 (21 residues), see Phobius details PF01654: Cyt_bd_oxida_I" amino acids 12 to 513 (502 residues), 545.2 bits, see alignment E=4.4e-168

Best Hits

KEGG orthology group: K00425, cytochrome bd-I oxidase subunit I [EC: 1.10.3.-] (inferred from 88% identity to pdi:BDI_2648)

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit I (EC 1.10.3.-)" in subsystem Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (516 amino acids)

>HMPREF1078_RS04500 cytochrome ubiquinol oxidase subunit I (Parabacteroides merdae CL09T00C40)
MIASIDTSLIDWSRAQFALTAMYHWLFVPLTLGLGVIQAIMETIYYKTGNEFWKKTAQFW
MKLFGINFAIGVATGLILEFEFGTNWSNYSWFVGDIFGAPLAIEGILAFFMEATFIAVMF
FGWDKVSKRFHLASTWLTIIGATLSALWILIANAWMQYPVGMHFNPDTVRNEMFDFWAVA
LSPVAINKFFHTVLSGWIVGAVFVMGVSSWYLLKKRETEFSLESIKVGAVFGLVASILIV
WTGDGSAYQVAQKQPMKLAAMEGLYEGGNGTGLVAIGLLNPDKTSYKDNVNPFIFDIKIP
KLLSFLAERDVDAYVPGIVNLIEGGYTTNKGTVALSAAEKIEKGRIAIQALADYRKAVKD
KDQVAAEQARSLLDENFAYFGYGYIKDPADLVPHVGLTFYSFRVMVLLGGYFILLFIVAL
IWSKKNKFADARWLQWASLWTIPLAYIAGQAGWIVAEVGRQPWAIQDILPTGASVSKLAT
SSVQTTFFVFLFLFTVLLIAEIGIMVKAIKKGPSVN