Protein Info for HMPREF1078_RS04495 in Parabacteroides merdae CL09T00C40

Annotation: cytochrome d ubiquinol oxidase subunit II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 384 transmembrane" amino acids 12 to 38 (27 residues), see Phobius details amino acids 59 to 79 (21 residues), see Phobius details amino acids 85 to 104 (20 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 176 to 200 (25 residues), see Phobius details amino acids 220 to 239 (20 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details amino acids 294 to 315 (22 residues), see Phobius details amino acids 344 to 363 (20 residues), see Phobius details PF02322: Cyt_bd_oxida_II" amino acids 8 to 365 (358 residues), 191.6 bits, see alignment E=1.1e-60

Best Hits

KEGG orthology group: K00426, cytochrome bd-I oxidase subunit II [EC: 1.10.3.-] (inferred from 86% identity to pdi:BDI_2649)

Predicted SEED Role

"Cytochrome d ubiquinol oxidase subunit II (EC 1.10.3.-)" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases or Conserved gene cluster associated with Met-tRNA formyltransferase or Terminal cytochrome d ubiquinol oxidases or Terminal cytochrome oxidases (EC 1.10.3.-)

Isozymes

Compare fitness of predicted isozymes for: 1.10.3.-

Use Curated BLAST to search for 1.10.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (384 amino acids)

>HMPREF1078_RS04495 cytochrome d ubiquinol oxidase subunit II (Parabacteroides merdae CL09T00C40)
MDSTYILLQHYWWFLVSLLGALLVFLLFVQGGQSLLFTIGKTELQQKMLLNSTGRKWEFT
FTTLVTFGGAFFASFPLFYSTSFGGAYWVWMLILACFVLQAVSYEYQSKKGNLLGKKTYQ
VFLLLNGILGPILLGTAVGTFFSGAEFVVNKGQLTDVAMPVISTWATPWHGLEAAFVFWN
VCLGLAVFFLARIQALLYFINNIDDAEIVKRSRKHLVIETALFLVFFLVFLVHLLLADGF
AVDPETKEVYMQPYKYFMNLVEMPAVPVVLLVGVAGVLYGIVRTILSDTWKKGIWFSGAG
TVLTVLALLLCAGWNNTAYYPSVADLQSSLTIGNSCSSPFTLEVMSYVSILVPFVLGYIF
YAWRALDLRKISGEEMQEKDTHAY