Protein Info for HMPREF1078_RS04440 in Parabacteroides merdae CL09T00C40

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 PF13614: AAA_31" amino acids 2 to 178 (177 residues), 242.8 bits, see alignment E=8e-76 PF06564: CBP_BcsQ" amino acids 3 to 247 (245 residues), 56.1 bits, see alignment E=1.5e-18 PF10609: ParA" amino acids 3 to 172 (170 residues), 35.3 bits, see alignment E=3e-12 PF09140: MipZ" amino acids 4 to 42 (39 residues), 23.5 bits, see alignment 1.2e-08 PF01656: CbiA" amino acids 5 to 229 (225 residues), 102.3 bits, see alignment E=6.8e-33 PF02374: ArsA_ATPase" amino acids 10 to 80 (71 residues), 32.2 bits, see alignment E=2.4e-11 PF00142: Fer4_NifH" amino acids 10 to 47 (38 residues), 29.3 bits, see alignment 2.1e-10

Best Hits

Swiss-Prot: 58% identical to SOJ_BACSU: Sporulation initiation inhibitor protein Soj (soj) from Bacillus subtilis (strain 168)

KEGG orthology group: K03496, chromosome partitioning protein (inferred from 92% identity to pdi:BDI_2559)

Predicted SEED Role

"Chromosome (plasmid) partitioning protein ParA" in subsystem Bacterial Cytoskeleton or Plasmid replication or Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (254 amino acids)

>HMPREF1078_RS04440 AAA family ATPase (Parabacteroides merdae CL09T00C40)
MGKIIALANQKGGVGKTTTTINLAASLAALEKKVLVVDADPQANASSGLGVDIRSVEQSI
YECVVNGDDPKGAITNTEVEGLDIIPSHIDLVGAEIEMLNMENREQILKQILVPLKERYD
YILIDCSPSLGLITVNALTAADSVMIPVQCEYFALEGISKLLNTIKIIKSKLNPALEIEG
FLLTMYDSRLRLANQIYEEVKRPFRDLVFTTVIQRNVKLSEASSYGKPVLLYDAESKGAL
NHMQLAQELIDKNK