Protein Info for HMPREF1078_RS04200 in Parabacteroides merdae CL09T00C40

Annotation: alkyl hydroperoxide reductase subunit F

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 TIGR03140: alkyl hydroperoxide reductase subunit F" amino acids 1 to 517 (517 residues), 770.7 bits, see alignment E=3.1e-236 PF13192: Thioredoxin_3" amino acids 124 to 189 (66 residues), 26.6 bits, see alignment E=2.8e-09 PF07992: Pyr_redox_2" amino acids 216 to 504 (289 residues), 169.2 bits, see alignment E=8.1e-53 PF13738: Pyr_redox_3" amino acids 264 to 487 (224 residues), 62.2 bits, see alignment E=2.8e-20 PF00070: Pyr_redox" amino acids 357 to 431 (75 residues), 51.7 bits, see alignment E=5.6e-17

Best Hits

KEGG orthology group: K03387, alkyl hydroperoxide reductase subunit F [EC: 1.6.4.-] (inferred from 78% identity to pdi:BDI_3397)

Predicted SEED Role

"Alkyl hydroperoxide reductase protein F (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.4.-

Use Curated BLAST to search for 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (521 amino acids)

>HMPREF1078_RS04200 alkyl hydroperoxide reductase subunit F (Parabacteroides merdae CL09T00C40)
MLDSAMKDQLSGIFSGLVSQYVFDIQVAPDHESRQELIDLLGDVASCSDHLSCSVADGEG
LQFTIVKDGMPTGIRFRAVPNGHEFTSLLLAVLNCDGKGKNIPDESICARVRALNGPIKL
TTYVSLTCTNCPDVVQALNVMATLNSRITHETVDGAINQKEVEAMKVQGVPSVFADGKLI
NVGRSDLGELLSKLEAQYGINEGGVDNSVEKPVKNYDVLIVGGGPAGAASAIYSARKGLN
VAVIAERIGGQVKETVGIENLISVPQTTGQQLANDLLTHINDYPVDILEHRRVDKVELDG
SAKLLTTSTGERFSAPALIVATGASWRKLNVPGEADYIGKGVAFCPHCDGPFYKGKHVAV
VGGGNSGIEAAIDLAGICSKVTVLEFMDELKADQVLQEKAKSLPNVEVFLHSQSLEVLGN
GDKVTGLRVKDRKTDAERVIDLDGIFVQIGLAANSGVFRDVVETNKPGEIVIDAHCRTNV
PGIYAAGDVSTVPYKQIIIAMGEGAKAALSAFEDRMRGLIG