Protein Info for HMPREF1078_RS03905 in Parabacteroides merdae CL09T00C40

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF13477: Glyco_trans_4_2" amino acids 10 to 121 (112 residues), 34.9 bits, see alignment E=6.2e-12 PF13439: Glyco_transf_4" amino acids 13 to 143 (131 residues), 46.9 bits, see alignment E=1.2e-15 PF13579: Glyco_trans_4_4" amino acids 13 to 143 (131 residues), 33.7 bits, see alignment E=1.6e-11 PF00534: Glycos_transf_1" amino acids 189 to 350 (162 residues), 131.4 bits, see alignment E=8.7e-42 PF20706: GT4-conflict" amino acids 193 to 314 (122 residues), 41.1 bits, see alignment E=4e-14 PF13692: Glyco_trans_1_4" amino acids 198 to 338 (141 residues), 104.1 bits, see alignment E=2.8e-33 PF13524: Glyco_trans_1_2" amino acids 276 to 360 (85 residues), 30.3 bits, see alignment E=1.3e-10

Best Hits

Predicted SEED Role

"Glycosyl transferase, group 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>HMPREF1078_RS03905 glycosyltransferase family 4 protein (Parabacteroides merdae CL09T00C40)
MNVLVCIPCLMTGGTEIQTLNLVKALITAEHKVTTVCYFEHSTNMVERYKQAGSNVCLLS
PDGKRPVGITNTVILLYKGLHRVLREVKPDVVHVQYMAPGAIPIIILRLLGIKRIVATAH
TAADIYLSLRLLHFVSRYILTAFQCITERAENSFFGNSQMYKAEMKLTRHGNHFTIYNNL
PPYISIANKEQRIGKVITIGVVSRLEPIKGMDLVVPAFAKIHAMNPNTRLLVVGDGSLCP
LMEQQKNDAGLNEVVKFAGVQPQEALQAYYDSIDILLMPSRSEGFGLTAIEGMARGCVVV
AANTGGLPEVVSDGKVGLLHEPESSDSLAEKAIRLVNDRELLMTMKQNAIGHVARFSFAH
YSELINNLYSKL