Protein Info for HMPREF1078_RS03630 in Parabacteroides merdae CL09T00C40

Annotation: aspartate kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 PF00696: AA_kinase" amino acids 2 to 275 (274 residues), 134.6 bits, see alignment E=4.9e-43 TIGR00657: aspartate kinase" amino acids 3 to 436 (434 residues), 285 bits, see alignment E=6.3e-89 PF22468: ACT_9" amino acids 377 to 434 (58 residues), 49.1 bits, see alignment 3.7e-17

Best Hits

KEGG orthology group: None (inferred from 96% identity to pdi:BDI_3936)

Predicted SEED Role

"Aspartokinase (EC 2.7.2.4)" in subsystem Lysine Biosynthesis DAP Pathway or Threonine and Homoserine Biosynthesis (EC 2.7.2.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.2.4

Use Curated BLAST to search for 2.7.2.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (442 amino acids)

>HMPREF1078_RS03630 aspartate kinase (Parabacteroides merdae CL09T00C40)
MKVLKFGGTSVGSAQRIKNVASIVCDQEQKIVVLSAMAGTTNSLVEISECFHKKDPEKAN
AVLSSLEQAYVNHIEELYRSDVYKEKAMQYMLERFQHVWSFSNMPFSVFDEKEILVQGEL
ISTFLMACYLEEQGVEVALLPALNFMRITVDNEPDMEYISKHLKVLLEQNKEAEIYITQG
FICRNAYGSIDNLERGGSDYTASLIGAAIQAEEIQIWTDIDGMHNNDPRFVNDTAPVRQL
NFDEAAKLAHFGAKILHPACILPAKEKNIPVRLLNALQPSASGTLISNTAEKEAIKAVAA
KDNITYVKIKSLHTIPTPHFLSIVFDTFYNYNTPVDMVTTSDIGVSVAIDNDKHIDEIVG
VLREYATITVEKNMVIVCVVGDLEWQNVGFEARIINALKDIPVRMISYGGSSSNVSLVMK
AEDKVHALKALSEHLFSVSDIY