Protein Info for HMPREF1078_RS03485 in Parabacteroides merdae CL09T00C40

Annotation: phosphomethylpyrimidine synthase ThiC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 568 PF13667: ThiC-associated" amino acids 11 to 90 (80 residues), 94.1 bits, see alignment E=3.8e-31 TIGR00190: phosphomethylpyrimidine synthase" amino acids 131 to 562 (432 residues), 669.8 bits, see alignment E=7.3e-206 PF01964: ThiC_Rad_SAM" amino acids 132 to 559 (428 residues), 608 bits, see alignment E=8.3e-187

Best Hits

Swiss-Prot: 72% identical to THIC_BACFN: Phosphomethylpyrimidine synthase (thiC) from Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343)

KEGG orthology group: K03147, thiamine biosynthesis protein ThiC (inferred from 88% identity to pdi:BDI_1059)

Predicted SEED Role

"Hydroxymethylpyrimidine phosphate synthase ThiC (EC 4.1.99.17)" (EC 4.1.99.17)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.99.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (568 amino acids)

>HMPREF1078_RS03485 phosphomethylpyrimidine synthase ThiC (Parabacteroides merdae CL09T00C40)
MANKNRIRITYPSSEKIYIPGKIHKINVGMRKIKILDTVTRDENGELVHKKNNPVIVYDT
SGPYSDPKIPVNTQNGIPRIRESWYAGRKDLIRLEELTSDYGRQRLADSSLDHIRFPKHH
LPYRAKAGKNITQLYYAKRRIITPEMEYVAIRENQQIEALGLKSYITPEFVRKEIAAGRA
IIPANINHPEAEPMIIGRKFLVKINTNIGNSALSSGIDEEIEKAVWSCKWGGDTLMDLST
GDNIHETREWIIRNCPVPMGTVPIYQALEKVNGKIEDLSWKIYRDTLIEQAEQGVDYFTI
HAGLLKKHIELTQTRLTGIVSRGGSIMAKWMQIHNEENFLYTHFAEICEILKMYDIAVSI
GDGLRPGSIYDANDAAQFAELHTMGELTQVAWDQFVQVIIEGPGHVPMNKIQENMKEQQY
ACHNAPFYTLGPLTTDIAPGYDHITSAIGAAQIAWHGTAMICYVTPKEHLGLPDKEDVRT
GVVTYKIAAHAADLAKGHPGAQVRDNALSKARFEFRWKDQFNLSFDPERAFQYYKDSAVT
DGEYCTMCGPNFCAMRLSKDLHKENCDI