Protein Info for HMPREF1078_RS03230 in Parabacteroides merdae CL09T00C40

Annotation: zincin-like metallopeptidase domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 PF08401: ArdcN" amino acids 15 to 145 (131 residues), 107.4 bits, see alignment E=6.1e-35 PF18818: MPTase-PolyVal" amino acids 200 to 318 (119 residues), 107.5 bits, see alignment E=4.9e-35

Best Hits

KEGG orthology group: None (inferred from 81% identity to bvu:BVU_3390)

Predicted SEED Role

"DNA primase TraC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (441 amino acids)

>HMPREF1078_RS03230 zincin-like metallopeptidase domain-containing protein (Parabacteroides merdae CL09T00C40)
MASGTDFQGNSGQAAIDRFAAMMIERMQQMKDTGWKQGWIGGASGYAGLPQNVGGRNYSG
SNSFFLQMHTAAMNYQLPVYLTFKQAHNLKAHVLRGEKSFPVVYWDMMIKDSHGKRISTE
EYRAMSKEEKKDMDVIPFIKSFPVYNVAQTNLAEVQPERMQKLMDRFKVPELRDTEGMYT
HAALDRMVETQQWLCPIRADKRENGAYYSPSKDIVVLPMKAQFNIGDSPEETYRGGMEYY
STMLHEMTHSTMTPERLNREMGGRFGDPKYAKEELVAELTAAMISHSMGFDSRITDNSAA
YLDSWIGVLKQEPKFIVSVMADVNKASDLILDHVDKQRLALGEQPYLAKNDPLAPVSADE
EMPFKNAAIVKTRSGDYAIRASYDGVELGLKKVSKETARTFFQLTDWKDKEAFLNMTARK
TYEPEITMMGRNRNARTGLGI