Protein Info for HMPREF1078_RS03170 in Parabacteroides merdae CL09T00C40

Annotation: type I restriction-modification system subunit M

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 380 to 403 (24 residues), see Phobius details TIGR00497: type I restriction-modification system, M subunit" amino acids 8 to 502 (495 residues), 469.1 bits, see alignment E=9.2e-145 PF12161: HsdM_N" amino acids 9 to 162 (154 residues), 57.9 bits, see alignment E=3.7e-19 PF02384: N6_Mtase" amino acids 178 to 481 (304 residues), 383 bits, see alignment E=2.3e-118 PF05175: MTS" amino acids 212 to 310 (99 residues), 26.4 bits, see alignment E=9.8e-10 PF13847: Methyltransf_31" amino acids 227 to 305 (79 residues), 27.1 bits, see alignment E=6.7e-10

Best Hits

KEGG orthology group: K03427, type I restriction enzyme M protein [EC: 2.1.1.72] (inferred from 95% identity to bth:BT_4538)

Predicted SEED Role

"Type I restriction-modification system, DNA-methyltransferase subunit M (EC 2.1.1.72)" in subsystem Restriction-Modification System (EC 2.1.1.72)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.72

Use Curated BLAST to search for 2.1.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (517 amino acids)

>HMPREF1078_RS03170 type I restriction-modification system subunit M (Parabacteroides merdae CL09T00C40)
MSEELQQKLRDQLWEVANRLRGNMSASDFMYFTLGFIFYKYLSEKIEKYANSALEDDEVT
FKELWDMTDADAAELQEEVKKQCLENIGYFIEPQFLFSSVIDTIKRKENILPMLERSLKR
IEDSTLGQDSEEDFGGLFSDIDLASPKLGKTADDKNTLVSNVLLALDDIDFGVEASQEID
ILGDAYEYMISQFAAGAGKKAGEFYTPQEVSRILAEIVSIGHQRLRNVYDPTCGSGSLLL
RAASIGKAVDIFGQEKNPTTYNLARMNMLLHGIKFSNFKIENGDTLEWDAFGDTQFDAVV
ANPPFSAEWSAADKFNNDDRFSKAGRLAPKKTADYAFILHMIYHLNEGGTMACVAPHGVL
FRGNAEGVIRRFLIEKKNYIDAIIGLPANIFYGTSIPTCILVFKKCRKEDDNILFIDASK
EFEKVKTQNKLRPQHIQKIVETYRDRKEIEKYSHLATLQEVADNDYNLNIPRYVDTFEEE
EPIDIKAVMAEIKELEAKRAELDKEIEVYLKELGLVE