Protein Info for HMPREF1078_RS02635 in Parabacteroides merdae CL09T00C40

Annotation: EpsG family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 transmembrane" amino acids 22 to 41 (20 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 109 to 138 (30 residues), see Phobius details amino acids 147 to 176 (30 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 246 to 264 (19 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details amino acids 299 to 319 (21 residues), see Phobius details amino acids 331 to 349 (19 residues), see Phobius details PF14897: EpsG" amino acids 29 to 351 (323 residues), 58 bits, see alignment E=4.7e-20

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>HMPREF1078_RS02635 EpsG family protein (Parabacteroides merdae CL09T00C40)
MLYPFPNVYRYGCEFRKRYTDILDYAVYGVLLILFCTFGYADNDFYHYEGLFKRICSTGL
NVHLEPVYYWLIRNVTSNYLVWRFIVWSGTVILSLWTIKRLKLDVRIGLLIFVLFYINII
SVMRGNLGIAILFFGFSFIIRPSHNRLLSFLFGCLLIFCSFFFHKSMLFSIAALSVTPFY
LNRKTVKISLVIFPFLTVVTTLLLDYIIMNGLIGFDIADMNIGSSMTGYASGTMRQSNIF
GKLNQMITYMPVYASLALMTKKIVFEEIDVPRYIKALFIYWYAITYIASLFFFQETSVWL
FIRFIMMSYFPLCIVVGYYYSNFKMTREKRILMLLAILPICYKLFYAFYKRLVWEGYVFF