Protein Info for HMPREF1078_RS02615 in Parabacteroides merdae CL09T00C40

Annotation: glycosyltransferase family 4 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 82 to 100 (19 residues), see Phobius details PF13579: Glyco_trans_4_4" amino acids 16 to 193 (178 residues), 52.5 bits, see alignment E=7.7e-18 PF00534: Glycos_transf_1" amino acids 214 to 371 (158 residues), 30.3 bits, see alignment E=2.9e-11

Best Hits

KEGG orthology group: None (inferred from 55% identity to pdi:BDI_1576)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>HMPREF1078_RS02615 glycosyltransferase family 4 protein (Parabacteroides merdae CL09T00C40)
MKILIVSFYYSPELGAAPSRITNMAEGLKSQGAEVDVLTCLPNYPQGQIFEGYRGRLSKK
EKINGINVYRYWTYATVSKNPFKRAVSMMSFATMLWLFAFKIKKIQGYDRVIIQSPPLPV
AGSAITLFKKIFGRKTLVNISDLWPLSAVELGAMREGGKIYDIFAWIERYIYRNADGIFG
QSEEIIRHVNQFPSTKNKFVYRNLQQYAVAAQPKRKHTPFRIVYAGLLGVAQDIYSIIEN
IPFQSIGAEFHLYGGGNQTEKIKEYINKHPGCFVYYHGYVKKEQIAEELSRYDASIVPLT
VAIKGAVPSKIYDLIPIGIPILFCGGGEGAEIVSKYYFGMVSKPHDFKQLHNNIIELINL
PDEEYSTISKNCLDMAKNEFDFNKQIYRCYDFIKSI