Protein Info for HMPREF1078_RS02480 in Parabacteroides merdae CL09T00C40

Annotation: mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 421 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 77 to 96 (20 residues), see Phobius details amino acids 102 to 127 (26 residues), see Phobius details amino acids 147 to 169 (23 residues), see Phobius details amino acids 175 to 200 (26 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 192 to 260 (69 residues), 52.1 bits, see alignment E=2.8e-18

Best Hits

KEGG orthology group: None (inferred from 80% identity to pdi:BDI_0961)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (421 amino acids)

>HMPREF1078_RS02480 mechanosensitive ion channel (Parabacteroides merdae CL09T00C40)
MHAIQEWINNHLIEWGIISSSANELDNTIVLLLIIAVTVGIDYACRYIFLNMFKRLAKRT
RNQWDDLIVERKIINKLMHMIPAILVYVLLPLAFPVDETPKILGILQMICKIYIIAVSLR
FISASLNVVHEIYNRKESLKNKPLKGFIQLLQVAVFFIGFILIISILIGKSPTTLFAGLG
ASAAILMLVFKDTLLGFVAGIQLSANDMLRPGDWITMEKYGANGTVIEVTLNAVKVKNFD
NTITTIPPYALVSDAFQNWRGMSESPGRRIKRSINIDMNSVSFCTPEMLAKFRKISLLTD
YIDEKEKELNAYNEAHRIDDSIRVNGRRQTNIGVFRAYLVNYLKSLPEVSKELTCMVRQL
QPTETGIPIELYFFSSVKDWVPYEGIQSDVFDHVLAVIPEFGLSVFQNVSGSDLRSLKIV
Q