Protein Info for HMPREF1078_RS02235 in Parabacteroides merdae CL09T00C40

Annotation: Na(+)-translocating NADH-quinone reductase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 449 PF05896: NQRA_N" amino acids 5 to 97 (93 residues), 114.9 bits, see alignment E=2.4e-37 TIGR01936: NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit" amino acids 5 to 448 (444 residues), 546.8 bits, see alignment E=2e-168 PF24836: NQRA_2nd" amino acids 114 to 253 (140 residues), 174.2 bits, see alignment E=2.7e-55 PF11973: NQRA_SLBB" amino acids 261 to 311 (51 residues), 49.3 bits, see alignment 8.3e-17

Best Hits

Swiss-Prot: 34% identical to NQRA_PHOLL: Na(+)-translocating NADH-quinone reductase subunit A (nqrA) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K00346, Na+-transporting NADH:ubiquinone oxidoreductase subunit A [EC: 1.6.5.-] (inferred from 86% identity to pdi:BDI_1125)

Predicted SEED Role

"Na(+)-translocating NADH-quinone reductase subunit A (EC 1.6.5.-)" in subsystem Na(+)-translocating NADH-quinone oxidoreductase and rnf-like group of electron transport complexes (EC 1.6.5.-)

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.-

Use Curated BLAST to search for 1.6.5.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (449 amino acids)

>HMPREF1078_RS02235 Na(+)-translocating NADH-quinone reductase subunit A (Parabacteroides merdae CL09T00C40)
MANVIKIKKGLDINLKGKASDVLLNGGKSDSYAIVPDYYNGIVPKVVAKVGEKVKAGSVL
MIDKNRPEIKFVSPVSGEVTAVNRGEKRKVLSVVVKPEAQIEYEDFGKKNVASLKREEVK
EAILHAGMWPFIKQRPYDIVASPADEPRDIFVSAFYSAPLAPNFDFVVKGQEVDFQTGLD
ALAKLTDGKVYVGIRKGSSVSVKGVETVEVEGPHPAANVGVQINHIKPINKGEVVWTVNP
ADVIVIGRLFNKGIADFSRLVVITGSETTERGYVKAIAGCTIASLVDGKIMRGNEDIRII
SGNVLTGTKVEKNDYLGAYDNQITVIPEGDETHDFFGWATPGFGKFSVSHSFPAWLMGKN
KEYVIDARIKGGKRAMIMSNEYDSVFPMDIMPEYLLKAIIAFDIDKMENLGIYEVAPEDF
ALCEFVDTSKLEIQKIVRQGLDVLYKEMN