Protein Info for HMPREF1078_RS02180 in Parabacteroides merdae CL09T00C40

Annotation: molecular chaperone HtpG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 PF13589: HATPase_c_3" amino acids 28 to 136 (109 residues), 39 bits, see alignment E=1.2e-13 PF02518: HATPase_c" amino acids 30 to 173 (144 residues), 29.8 bits, see alignment E=1e-10 PF00183: HSP90" amino acids 215 to 581 (367 residues), 157.8 bits, see alignment E=7.6e-50

Best Hits

Swiss-Prot: 70% identical to HTPG_BACFR: Chaperone protein htpG (htpG) from Bacteroides fragilis (strain YCH46)

KEGG orthology group: K04079, molecular chaperone HtpG (inferred from 88% identity to pdi:BDI_0681)

Predicted SEED Role

"Chaperone protein HtpG" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (683 amino acids)

>HMPREF1078_RS02180 molecular chaperone HtpG (Parabacteroides merdae CL09T00C40)
MAKQGNIGVTSENIFPIIKKFLYSDHEIFLRELVSNAVDATQKLKTLASVGEFKGELGDL
TVHVSFDSNTIKISDRGIGMTAEEIDKYINQIAFSGAEEFVEKYKNDAAAIIGHFGLGFY
SSFMVSKKVEIVTKSYKEGAVPMKWSCDGTPEYTLEETEKEDRGTDIILYIDDENKDFLN
KDKINSLLTKYCRYLPVPIAFGKKQEWKDGKYVDTDEDNIINDIQPAWVRKPTDMTDEDY
KKFYQDLYPMSDEPLFWIHLNVDYPFHLTGILYFPRIKSNIDLHRNKIQLYCNQVFVTDS
VEGIVPEFLTLLHGVLDSPDIPLNVSRSYLQSDQNVKKISNHIMKKVADRLEEMFKNDRP
QFEEKWDSLKLFIQYGMLSEEKFYDRAAKFALLKDVDGKYYTFEEYKALTEANQTDKEGN
LIYLYTTNANDQYSYIQAAKDKAYSVLIMDGQLDVHAISQMEQKFEKTRFVRVDSDTIDN
LIRKDNVNKVTLNEDEKNALQEMFKSQLPKIEKTDFIVTFEALGENSNPVMLTQSEYMRR
MREMSAMQPGMSFYGELPDNYNLVLNTDHELVKKILSEEEAACAEKLNPILSDLKGWKAR
QSDLREAQSKKKEEEITSEEKEDMTNTNKKIDELVEQRNSILSEYAGGNKLVSQLIDLAL
LANGMLKGEALSQFIKRSVQMIG