Protein Info for HMPREF1078_RS02130 in Parabacteroides merdae CL09T00C40

Annotation: hybrid sensor histidine kinase/response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 372 PF00072: Response_reg" amino acids 10 to 121 (112 residues), 108.4 bits, see alignment E=4.5e-35 PF00512: HisKA" amino acids 144 to 208 (65 residues), 27.1 bits, see alignment E=7.2e-10 PF13581: HATPase_c_2" amino acids 255 to 346 (92 residues), 32.6 bits, see alignment E=1.4e-11 PF02518: HATPase_c" amino acids 259 to 368 (110 residues), 90.9 bits, see alignment E=1.5e-29

Best Hits

KEGG orthology group: None (inferred from 83% identity to pdi:BDI_1298)

Predicted SEED Role

"Two-component system sensor histidine kinase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (372 amino acids)

>HMPREF1078_RS02130 hybrid sensor histidine kinase/response regulator (Parabacteroides merdae CL09T00C40)
MENLASQYTVLVVDDVPTNVMLVQAILKKEGYTLLTTDSGAKALRIAQERHPNLILLDIM
MPEMDGYEVLQHLKSNPETNNIPVIIMSALSDMQSIVKGYQLGATEYVTKPFQREELVKR
VAHRYELFSIKRIKQELENTIESRDTLYSVIAHDLRSPLGSLKMMNNAILMMVDKNQVSD
EVYEMLQMMNKTSEEIFQLLDNLLKWAKNRLNKQNIYRQQVDINSIVNSTAEIFIPMATQ
KGISIMLEGLDKELMGSTDIDMVKTIVRNLISNAVKFSYEKGLITVSTKTDGDFVVVSVK
DSGKGIKKEDQGKLLRPNTHFTSYGTNNEKGSGLGLMLCKDFVEQLGGKLWFDSEEGKGT
TFYFSLKVSNQE