Protein Info for HMPREF1078_RS01835 in Parabacteroides merdae CL09T00C40

Annotation: DUF58 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 PF01882: DUF58" amino acids 42 to 252 (211 residues), 268.8 bits, see alignment E=4.1e-84 PF13519: VWA_2" amino acids 79 to 184 (106 residues), 59.4 bits, see alignment E=7.2e-20 PF00092: VWA" amino acids 79 to 174 (96 residues), 26.2 bits, see alignment E=1.3e-09

Best Hits

KEGG orthology group: None (inferred from 93% identity to pdi:BDI_0946)

Predicted SEED Role

"hypothetical protein PA3071"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>HMPREF1078_RS01835 DUF58 domain-containing protein (Parabacteroides merdae CL09T00C40)
METSELLKKVRRIEIKTRGLSRNIFAGQYHSAFKGRGMAFSEVREYQYGDDIRDIDWNVT
ARYVRPYVKVFEEERELTVMLLIDVSGSRDFGSVNVMKKEVITEIAATLAFSAIQNNDKI
GVVFFSDKIEKFIPPQKGKKHILYVIRELIDFQPDKKQTNIAQALKYLTNAIKKRCTAFL
ISDFIDKDGFKDALTIANRKHDVVAIQVYDRRETELPAVGLMKIKDAETGQERWIDSSSA
RVRAAYKEWWDRRQAAMSDSFKKCRVDSVSIRTEDDYVKALIALFDKRN