Protein Info for HMPREF1078_RS01830 in Parabacteroides merdae CL09T00C40

Annotation: MoxR family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF20030: bpMoxR" amino acids 24 to 195 (172 residues), 53.6 bits, see alignment E=5e-18 PF00493: MCM" amino acids 45 to 167 (123 residues), 24.6 bits, see alignment E=3.8e-09 PF07728: AAA_5" amino acids 51 to 179 (129 residues), 52.4 bits, see alignment E=1.8e-17 PF07726: AAA_3" amino acids 51 to 181 (131 residues), 224.5 bits, see alignment E=1e-70 PF17863: AAA_lid_2" amino acids 257 to 324 (68 residues), 72.2 bits, see alignment E=7.3e-24

Best Hits

KEGG orthology group: K03924, MoxR-like ATPase [EC: 3.6.3.-] (inferred from 95% identity to pdi:BDI_0945)

Predicted SEED Role

"MoxR-like ATPase in aerotolerance operon"

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>HMPREF1078_RS01830 MoxR family ATPase (Parabacteroides merdae CL09T00C40)
MSQTVDIRELNERIESKSSFVNMITMGMDQVIVGQKHLVESLLIGLLSDGHILLEGVPGL
AKTLAIKTLASLIDAKYSRIQFTPDLLPADVIGTMIYSQKSEEFQVKQGPVFANFVLADE
INRAPAKVQSALLEAMQERQVTISENTYRLPSPFLVMATQNPIEQEGTYPLPEAQVDRFM
LKVIINYPKKEEEKLIIRQNISGVKPDIKPILTKEEILEARKVVREVYLDEKIERYIVDI
VFATRFPQEHGLANLANMISFGASPRASISLALAARAYAFIKRRGYVIPEDIRAVCHDVM
RHRIGLSYEAEANNLTSEEVISEILNKVEVP