Protein Info for HMPREF1078_RS01660 in Parabacteroides merdae CL09T00C40

Annotation: septal ring lytic transglycosylase RlpA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 153 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03330: DPBB_1" amino acids 25 to 114 (90 residues), 71.3 bits, see alignment E=3.2e-24 TIGR00413: rare lipoprotein A" amino acids 27 to 117 (91 residues), 126.2 bits, see alignment E=8.3e-41

Best Hits

KEGG orthology group: K03642, rare lipoprotein A (inferred from 70% identity to pdi:BDI_1049)

Predicted SEED Role

"Rare lipoprotein A precursor" in subsystem Peptidoglycan Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (153 amino acids)

>HMPREF1078_RS01660 septal ring lytic transglycosylase RlpA family protein (Parabacteroides merdae CL09T00C40)
MPFRLVHIILLLVAFAGTGDVWGQEEGLASYYHNRFHGRKAASGRVHDADELVAAHRTYP
FGTFLRVTNLSNMKRVIVCVTDRGPFRKGRIIDVSAGAAELLDFKKKGLARVRIEVVPGK
IDLSLLDLLYPKIPFLEVDHLRVRPPYRIGKNK